PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02609.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 305aa    MW: 33098.9 Da    PI: 8.5005
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02609.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.76.4e-19752147
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                             +g+W++eEde+l ++v ++G+++W+ I + ++ gR++k+c++rw + 
  Rsa1.0_02609.1_g00002.1  7 KGPWSPEEDEQLRKLVVEHGPRNWTVIGKSIP-GRSGKSCRLRWCNQ 52
                             79******************************.***********985 PP

2Myb_DNA-binding551.8e-1761103347
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              ++++eEde +++a++q+G++ W++Iar ++ gRt++ +k++w++ 
  Rsa1.0_02609.1_g00002.1  61 PFSAEEDETIARAHAQFGNK-WAAIARLLN-GRTDNAVKNHWNST 103
                              89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.861257IPR017930Myb domain
SuperFamilySSF466894.12E-304100IPR009057Homeodomain-like
SMARTSM007177.6E-17655IPR001005SANT/Myb domain
PfamPF002492.1E-18752IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-24859IPR009057Homeodomain-like
CDDcd001674.84E-16951No hitNo description
SMARTSM007178.3E-1558106IPR001005SANT/Myb domain
PROSITE profilePS5129419.48559108IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2260107IPR009057Homeodomain-like
PfamPF002494.7E-1561103IPR001005SANT/Myb domain
CDDcd001675.22E-1261104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MADDRIKGPW SPEEDEQLRK LVVEHGPRNW TVIGKSIPGR SGKSCRLRWC NQLSPQVEHR  60
PFSAEEDETI ARAHAQFGNK WAAIARLLNG RTDNAVKNHW NSTLKRKCGG AEEDHRPAKR  120
SVSDGAPPVA NGLYMGPGSP TGSDVSDSST LPVFPSAEVF KPVPRAAGSV MLPLQIETTS  180
SSSFDDPATS LSLSLPGADV SEESNRSHES TNNNNKPMRR DINTMSFMRF SGGFRGAIEE  240
MGRSFGGNGG SEFMAVVQEM IKAEVRSYMK EMQRNNNNGG GGGFVGGFRD SGLISMSRVG  300
VGRIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C1e-3861083105C-Myb DNA-Binding Domain
1mse_C1e-3861083105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9667370.0KC966737.1 Brassica napus MYB transcription factor 44 (MYB44.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009103434.11e-176PREDICTED: transcription factor MYB44
SwissprotQ9FDW11e-161MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0M4MB331e-176A0A0M4MB33_BRANA; MYB44 transcription factor protein
TrEMBLM4D6P01e-176M4D6P0_BRARP; Uncharacterized protein
STRINGBra012149.1-P1e-176(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67728135
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.11e-161myb domain protein r1